- glycerol-3-phosphate permease Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-87524
- 0.1 ml (also 25ul)
- Rabbit
- glycerol-3-phosphate permease
- Unconjugated
- Human
- Immunohistochemistry, Immunohistochemistry-Paraffin
- PBS (pH 7.2) and 40% Glycerol
- This antibody was developed against Recombinant Protein corresponding to amino acids: IVKGELHKYC TAWDEADVRF SSQNRKSGSA APHQLPDNET DCGWAPFDKN NY
- G3PP, SPX1
- solute carrier family 37 member 1
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
IVKGELHKYCTAWDEADVRFSSQNRKSGSAAPHQLPDNETDCGWAPFDKNNY
Specifications/Features
Available conjugates: Unconjugated